Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 243571..244207 | Replicon | chromosome |
| Accession | NZ_CP115153 | ||
| Organism | Sutcliffiella sp. NC1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A223KXJ3 |
| Locus tag | O1A01_RS01295 | Protein ID | WP_066417781.1 |
| Coordinates | 243857..244207 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A223KXF9 |
| Locus tag | O1A01_RS01290 | Protein ID | WP_066417778.1 |
| Coordinates | 243571..243852 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1A01_RS01270 (O1A01_01270) | 239761..240486 | - | 726 | WP_270065404.1 | rhomboid family intramembrane serine protease | - |
| O1A01_RS01275 (O1A01_01275) | 240561..240920 | + | 360 | WP_066417765.1 | holo-ACP synthase | - |
| O1A01_RS01280 (O1A01_01280) | 241083..242111 | + | 1029 | WP_268874278.1 | outer membrane lipoprotein carrier protein LolA | - |
| O1A01_RS01285 (O1A01_01285) | 242264..243424 | + | 1161 | WP_270065405.1 | alanine racemase | - |
| O1A01_RS01290 (O1A01_01290) | 243571..243852 | + | 282 | WP_066417778.1 | antitoxin endoai | Antitoxin |
| O1A01_RS01295 (O1A01_01295) | 243857..244207 | + | 351 | WP_066417781.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| O1A01_RS01300 (O1A01_01300) | 244501..245328 | + | 828 | WP_270065406.1 | STAS domain-containing protein | - |
| O1A01_RS01305 (O1A01_01305) | 245325..245681 | + | 357 | WP_270065407.1 | STAS domain-containing protein | - |
| O1A01_RS01310 (O1A01_01310) | 245686..246087 | + | 402 | WP_270065408.1 | anti-sigma regulatory factor | - |
| O1A01_RS01315 (O1A01_01315) | 246104..247108 | + | 1005 | WP_270065409.1 | PP2C family protein-serine/threonine phosphatase | - |
| O1A01_RS01320 (O1A01_01320) | 247218..247526 | + | 309 | WP_270065410.1 | STAS domain-containing protein | - |
| O1A01_RS01325 (O1A01_01325) | 247549..248025 | + | 477 | WP_270065411.1 | anti-sigma B factor RsbW | - |
| O1A01_RS01330 (O1A01_01330) | 248000..248785 | + | 786 | WP_270065412.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13048.07 Da Isoelectric Point: 4.8891
>T267058 WP_066417781.1 NZ_CP115153:243857-244207 [Sutcliffiella sp. NC1]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTIIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDEEMMDRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTIIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDEEMMDRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A223KXJ3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A223KXF9 |