Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 86578..87248 Replicon plasmid IncHI1BpNDM-MAR
Accession NZ_CP115151
Organism Enterobacter hormaechei subsp. xiangfangensis strain MDCL 3

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag MUY00_RS23695 Protein ID WP_004213072.1
Coordinates 86578..87021 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag MUY00_RS23700 Protein ID WP_004213073.1
Coordinates 87018..87248 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MUY00_RS23660 (MUY00_23655) 81987..82262 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
MUY00_RS23665 (MUY00_23660) 82325..82816 + 492 WP_011251327.1 DM13 domain-containing protein -
MUY00_RS23670 (MUY00_23665) 82865..83785 + 921 WP_029884592.1 DUF1471 domain-containing protein -
MUY00_RS23675 (MUY00_23670) 83876..84279 + 404 Protein_90 GAF domain-containing protein -
MUY00_RS23680 (MUY00_23675) 84797..85434 - 638 Protein_91 mucoid phenotype regulator RmpA2 -
MUY00_RS23685 (MUY00_23680) 85851..86155 + 305 Protein_92 transposase -
MUY00_RS23690 (MUY00_23685) 86178..86429 - 252 WP_186987481.1 hypothetical protein -
MUY00_RS23695 (MUY00_23690) 86578..87021 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
MUY00_RS23700 (MUY00_23695) 87018..87248 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MUY00_RS23705 (MUY00_23700) 87856..88989 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
MUY00_RS23710 (MUY00_23705) 89005..89298 + 294 WP_004213076.1 hypothetical protein -
MUY00_RS23715 (MUY00_23710) 89288..89494 - 207 WP_004213077.1 hypothetical protein -
MUY00_RS23720 (MUY00_23715) 89846..90136 + 291 WP_004213078.1 hypothetical protein -
MUY00_RS23725 (MUY00_23720) 90126..91025 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid rmtC / blaNDM-1 / sul1 / aac(3)-IId / qacE / aac(6')-Ib iucA / iucB / iucC / iucD / iutA / rmpA 1..200030 200030


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T267057 WP_004213072.1 NZ_CP115151:c87021-86578 [Enterobacter hormaechei subsp. xiangfangensis]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT267057 WP_004213073.1 NZ_CP115151:c87248-87018 [Enterobacter hormaechei subsp. xiangfangensis]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References