Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 32959..33695 | Replicon | plasmid IncHI1BpNDM-MAR |
| Accession | NZ_CP115151 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain MDCL 3 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | MUY00_RS23400 | Protein ID | WP_004098919.1 |
| Coordinates | 33213..33695 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
| Locus tag | MUY00_RS23395 | Protein ID | WP_004213599.1 |
| Coordinates | 32959..33225 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUY00_RS23375 (MUY00_23370) | 30472..31476 | + | 1005 | WP_000427623.1 | IS110-like element IS4321 family transposase | - |
| MUY00_RS23380 (MUY00_23375) | 31762..32256 | + | 495 | WP_004213594.1 | hypothetical protein | - |
| MUY00_RS23385 (MUY00_23380) | 32317..32520 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| MUY00_RS23390 (MUY00_23385) | 32534..32764 | + | 231 | WP_004213598.1 | hypothetical protein | - |
| MUY00_RS23395 (MUY00_23390) | 32959..33225 | + | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
| MUY00_RS23400 (MUY00_23395) | 33213..33695 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| MUY00_RS23405 (MUY00_23400) | 33896..35299 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| MUY00_RS23410 (MUY00_23405) | 35328..35960 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| MUY00_RS23415 (MUY00_23410) | 36035..37003 | + | 969 | WP_004099053.1 | IS5-like element IS903B family transposase | - |
| MUY00_RS23420 (MUY00_23415) | 37465..38692 | + | 1228 | Protein_39 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | rmtC / blaNDM-1 / sul1 / aac(3)-IId / qacE / aac(6')-Ib | iucA / iucB / iucC / iucD / iutA / rmpA | 1..200030 | 200030 | |
| - | inside | IScluster/Tn | rmtC / blaNDM-1 / sul1 / aac(3)-IId | - | 16..38692 | 38676 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T267056 WP_004098919.1 NZ_CP115151:33213-33695 [Enterobacter hormaechei subsp. xiangfangensis]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D3T1D0 |