Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4415762..4416382 Replicon chromosome
Accession NZ_CP115150
Organism Enterobacter hormaechei subsp. xiangfangensis strain MDCL 3

Toxin (Protein)


Gene name Hha Uniprot ID A0A837FFM2
Locus tag MUY00_RS21505 Protein ID WP_015571250.1
Coordinates 4416164..4416382 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID F5RUW7
Locus tag MUY00_RS21500 Protein ID WP_006809850.1
Coordinates 4415762..4416136 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MUY00_RS21490 (MUY00_21485) 4410889..4412082 + 1194 WP_022650498.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
MUY00_RS21495 (MUY00_21490) 4412105..4415251 + 3147 WP_022650497.1 multidrug efflux RND transporter permease subunit AcrB -
MUY00_RS21500 (MUY00_21495) 4415762..4416136 + 375 WP_006809850.1 Hha toxicity modulator TomB Antitoxin
MUY00_RS21505 (MUY00_21500) 4416164..4416382 + 219 WP_015571250.1 HHA domain-containing protein Toxin
MUY00_RS21510 (MUY00_21505) 4416591..4417142 + 552 WP_058656581.1 maltose O-acetyltransferase -
MUY00_RS21515 (MUY00_21510) 4417259..4417726 + 468 WP_022650495.1 YlaC family protein -
MUY00_RS21520 (MUY00_21515) 4417698..4419158 - 1461 WP_032608667.1 PLP-dependent aminotransferase family protein -
MUY00_RS21525 (MUY00_21520) 4419260..4419970 + 711 WP_058656580.1 GNAT family protein -
MUY00_RS21530 (MUY00_21525) 4419967..4420107 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
MUY00_RS21535 (MUY00_21530) 4420110..4420370 - 261 WP_015571255.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8583.95 Da        Isoelectric Point: 8.9008

>T267055 WP_015571250.1 NZ_CP115150:4416164-4416382 [Enterobacter hormaechei subsp. xiangfangensis]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14497.28 Da        Isoelectric Point: 4.8989

>AT267055 WP_006809850.1 NZ_CP115150:4415762-4416136 [Enterobacter hormaechei subsp. xiangfangensis]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837FFM2

Antitoxin

Source ID Structure
AlphaFold DB A0A837FGN8

References