Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3184337..3185076 | Replicon | chromosome |
| Accession | NZ_CP115150 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain MDCL 3 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
| Locus tag | MUY00_RS15260 | Protein ID | WP_003857133.1 |
| Coordinates | 3184591..3185076 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | MUY00_RS15255 | Protein ID | WP_003857131.1 |
| Coordinates | 3184337..3184603 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUY00_RS15235 (MUY00_15235) | 3179813..3180799 | + | 987 | WP_003857123.1 | DUF979 domain-containing protein | - |
| MUY00_RS15240 (MUY00_15240) | 3180809..3181804 | + | 996 | WP_003857125.1 | DUF2891 domain-containing protein | - |
| MUY00_RS15245 (MUY00_15245) | 3181826..3183214 | - | 1389 | WP_058657060.1 | MFS transporter | - |
| MUY00_RS15250 (MUY00_15250) | 3183344..3184273 | + | 930 | WP_022651200.1 | LysR family transcriptional regulator | - |
| MUY00_RS15255 (MUY00_15255) | 3184337..3184603 | + | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| MUY00_RS15260 (MUY00_15260) | 3184591..3185076 | + | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
| MUY00_RS15265 (MUY00_15265) | 3185254..3185685 | - | 432 | WP_234783248.1 | hypothetical protein | - |
| MUY00_RS15270 (MUY00_15270) | 3185660..3185785 | - | 126 | WP_265114096.1 | hypothetical protein | - |
| MUY00_RS15275 (MUY00_15275) | 3185923..3186507 | + | 585 | WP_058657062.1 | GDP-mannose pyrophosphatase | - |
| MUY00_RS15280 (MUY00_15280) | 3186592..3187350 | + | 759 | WP_058657064.1 | trans-aconitate 2-methyltransferase | - |
| MUY00_RS15285 (MUY00_15285) | 3187357..3188547 | - | 1191 | WP_023314158.1 | cytochrome c biogenesis protein/redoxin | - |
| MUY00_RS15290 (MUY00_15290) | 3188683..3189978 | - | 1296 | WP_032609216.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T267054 WP_003857133.1 NZ_CP115150:3184591-3185076 [Enterobacter hormaechei subsp. xiangfangensis]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L9PBP9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |