Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1686371..1687028 | Replicon | chromosome |
| Accession | NZ_CP115150 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain MDCL 3 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0A6GSQ9 |
| Locus tag | MUY00_RS08095 | Protein ID | WP_022649305.1 |
| Coordinates | 1686618..1687028 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | MUY00_RS08090 | Protein ID | WP_003863437.1 |
| Coordinates | 1686371..1686637 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUY00_RS08070 (MUY00_08070) | 1681803..1683236 | - | 1434 | WP_003863430.1 | 6-phospho-beta-glucosidase BglA | - |
| MUY00_RS08075 (MUY00_08075) | 1683353..1684084 | - | 732 | WP_003863431.1 | MurR/RpiR family transcriptional regulator | - |
| MUY00_RS08080 (MUY00_08080) | 1684351..1685010 | + | 660 | WP_058656477.1 | hemolysin III family protein | - |
| MUY00_RS08085 (MUY00_08085) | 1685096..1686076 | - | 981 | WP_058656478.1 | tRNA-modifying protein YgfZ | - |
| MUY00_RS08090 (MUY00_08090) | 1686371..1686637 | + | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| MUY00_RS08095 (MUY00_08095) | 1686618..1687028 | + | 411 | WP_022649305.1 | protein YgfX | Toxin |
| MUY00_RS08100 (MUY00_08100) | 1687030..1687551 | - | 522 | WP_003863440.1 | flavodoxin FldB | - |
| MUY00_RS08105 (MUY00_08105) | 1687653..1688549 | + | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| MUY00_RS08110 (MUY00_08110) | 1688578..1689291 | + | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| MUY00_RS08115 (MUY00_08115) | 1689297..1691030 | + | 1734 | WP_003863445.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T267048 WP_022649305.1 NZ_CP115150:1686618-1687028 [Enterobacter hormaechei subsp. xiangfangensis]
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A6GSQ9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |