Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 1516706..1517385 | Replicon | chromosome |
| Accession | NZ_CP115150 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain MDCL 3 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A0C7K7A4 |
| Locus tag | MUY00_RS07270 | Protein ID | WP_020324801.1 |
| Coordinates | 1517044..1517385 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | MUY00_RS07265 | Protein ID | WP_274413776.1 |
| Coordinates | 1516706..1517023 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUY00_RS07240 (MUY00_07240) | 1511920..1515072 | + | 3153 | WP_274413882.1 | AIDA repeat-containing protein | - |
| MUY00_RS07245 (MUY00_07245) | 1515165..1515404 | + | 240 | WP_163190131.1 | DUF905 domain-containing protein | - |
| MUY00_RS07250 (MUY00_07250) | 1515507..1515965 | + | 459 | WP_163190129.1 | antirestriction protein | - |
| MUY00_RS07255 (MUY00_07255) | 1515981..1516457 | + | 477 | WP_020324797.1 | RadC family protein | - |
| MUY00_RS07260 (MUY00_07260) | 1516466..1516693 | + | 228 | WP_020324796.1 | DUF987 domain-containing protein | - |
| MUY00_RS07265 (MUY00_07265) | 1516706..1517023 | + | 318 | WP_274413776.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| MUY00_RS07270 (MUY00_07270) | 1517044..1517385 | + | 342 | WP_020324801.1 | TA system toxin CbtA family protein | Toxin |
| MUY00_RS07275 (MUY00_07275) | 1517501..1518334 | + | 834 | WP_020324805.1 | DUF4942 domain-containing protein | - |
| MUY00_RS07285 (MUY00_07285) | 1518637..1519143 | + | 507 | WP_022651878.1 | G/U mismatch-specific DNA glycosylase | - |
| MUY00_RS07290 (MUY00_07290) | 1519245..1521089 | - | 1845 | WP_006812010.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1488679..1518334 | 29655 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12818.91 Da Isoelectric Point: 9.1484
>T267047 WP_020324801.1 NZ_CP115150:1517044-1517385 [Enterobacter hormaechei subsp. xiangfangensis]
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
Download Length: 342 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11923.52 Da Isoelectric Point: 6.4644
>AT267047 WP_274413776.1 NZ_CP115150:1516706-1517023 [Enterobacter hormaechei subsp. xiangfangensis]
MSNITWGLQRDTTPRLGARLVQEGNQLHYLADRASITGKFSDAECRKLDETFPYFISQMESMLITGEMNPRHAHCVTLYH
NGFTCEADTLGSCGYVYIAVYPIQR
MSNITWGLQRDTTPRLGARLVQEGNQLHYLADRASITGKFSDAECRKLDETFPYFISQMESMLITGEMNPRHAHCVTLYH
NGFTCEADTLGSCGYVYIAVYPIQR
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|