Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 432194..432790 | Replicon | chromosome |
| Accession | NZ_CP115150 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain MDCL 3 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A837F9W8 |
| Locus tag | MUY00_RS02160 | Protein ID | WP_023315213.1 |
| Coordinates | 432194..432496 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | MUY00_RS02165 | Protein ID | WP_023315212.1 |
| Coordinates | 432503..432790 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUY00_RS02140 (MUY00_02140) | 428413..429762 | + | 1350 | WP_003860344.1 | lysine-sensitive aspartokinase 3 | - |
| MUY00_RS02145 (MUY00_02145) | 429856..430800 | + | 945 | WP_022650218.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| MUY00_RS02150 (MUY00_02150) | 430851..431123 | + | 273 | WP_003860346.1 | DUF3811 domain-containing protein | - |
| MUY00_RS02155 (MUY00_02155) | 431124..431996 | - | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| MUY00_RS02160 (MUY00_02160) | 432194..432496 | + | 303 | WP_023315213.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MUY00_RS02165 (MUY00_02165) | 432503..432790 | + | 288 | WP_023315212.1 | putative addiction module antidote protein | Antitoxin |
| MUY00_RS02170 (MUY00_02170) | 432787..434418 | - | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11427.21 Da Isoelectric Point: 10.1042
>T267046 WP_023315213.1 NZ_CP115150:432194-432496 [Enterobacter hormaechei subsp. xiangfangensis]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRVYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRVYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10171.73 Da Isoelectric Point: 7.0086
>AT267046 WP_023315212.1 NZ_CP115150:432503-432790 [Enterobacter hormaechei subsp. xiangfangensis]
MHKLTPYDPANALVDDEEIAVFMADALETGDSAYIAKALGVIARAKGMSTISLQTGLSREQLYRSFSDKGNPTLKTTLAV
MKALGLRLTIKPSGD
MHKLTPYDPANALVDDEEIAVFMADALETGDSAYIAKALGVIARAKGMSTISLQTGLSREQLYRSFSDKGNPTLKTTLAV
MKALGLRLTIKPSGD
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|