Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 2003369..2003916 | Replicon | chromosome |
Accession | NZ_CP114976 | ||
Organism | Denitrificimonas caeni strain CE14 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | O6P33_RS09475 | Protein ID | WP_269817539.1 |
Coordinates | 2003369..2003671 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | O6P33_RS09480 | Protein ID | WP_100689219.1 |
Coordinates | 2003659..2003916 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6P33_RS09460 (O6P33_09460) | 2000219..2000512 | - | 294 | WP_269817536.1 | DUF1883 domain-containing protein | - |
O6P33_RS09465 (O6P33_09465) | 2000748..2001890 | + | 1143 | WP_269817537.1 | MFS transporter | - |
O6P33_RS09470 (O6P33_09470) | 2002226..2003179 | + | 954 | WP_269817538.1 | NAD(P)-dependent oxidoreductase | - |
O6P33_RS09475 (O6P33_09475) | 2003369..2003671 | - | 303 | WP_269817539.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O6P33_RS09480 (O6P33_09480) | 2003659..2003916 | - | 258 | WP_100689219.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
O6P33_RS09485 (O6P33_09485) | 2004046..2005671 | - | 1626 | WP_269817540.1 | DUF2326 domain-containing protein | - |
O6P33_RS09490 (O6P33_09490) | 2005665..2005886 | - | 222 | WP_269817541.1 | hypothetical protein | - |
O6P33_RS09495 (O6P33_09495) | 2005883..2006686 | - | 804 | WP_269817542.1 | HNH endonuclease signature motif containing protein | - |
O6P33_RS09500 (O6P33_09500) | 2007293..2007754 | - | 462 | WP_269817543.1 | hypothetical protein | - |
O6P33_RS09505 (O6P33_09505) | 2007751..2008107 | - | 357 | WP_269817544.1 | hypothetical protein | - |
O6P33_RS09510 (O6P33_09510) | 2008257..2008673 | - | 417 | WP_269819461.1 | DUF1090 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11608.28 Da Isoelectric Point: 4.4755
>T267044 WP_269817539.1 NZ_CP114976:c2003671-2003369 [Denitrificimonas caeni]
MAEIIWTEPALHELDALAEYVALDNPEAASHLVEKVFDKIESLENFPQSGRVPPGLPNSVYREVVVTPCRIFYREDDKRV
LILYVMREERQLRAYMLESS
MAEIIWTEPALHELDALAEYVALDNPEAASHLVEKVFDKIESLENFPQSGRVPPGLPNSVYREVVVTPCRIFYREDDKRV
LILYVMREERQLRAYMLESS
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|