Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2725117..2725753 | Replicon | chromosome |
Accession | NZ_CP114899 | ||
Organism | Bacillus subtilis strain |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | O6U12_RS14645 | Protein ID | WP_003156187.1 |
Coordinates | 2725117..2725467 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | O6U12_RS14650 | Protein ID | WP_003225183.1 |
Coordinates | 2725472..2725753 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6U12_RS14605 (O6U12_14605) | 2720171..2720770 | - | 600 | WP_017696999.1 | phosphoserine phosphatase RsbX | - |
O6U12_RS14610 (O6U12_14610) | 2720770..2721558 | - | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
O6U12_RS14615 (O6U12_14615) | 2721524..2722006 | - | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
O6U12_RS14620 (O6U12_14620) | 2722003..2722332 | - | 330 | WP_014662855.1 | anti-sigma factor antagonist RsbV | - |
O6U12_RS14625 (O6U12_14625) | 2722394..2723401 | - | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
O6U12_RS14630 (O6U12_14630) | 2723413..2723814 | - | 402 | WP_017697001.1 | serine/threonine-protein kinase RsbT | - |
O6U12_RS14635 (O6U12_14635) | 2723818..2724183 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
O6U12_RS14640 (O6U12_14640) | 2724188..2725012 | - | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
O6U12_RS14645 (O6U12_14645) | 2725117..2725467 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
O6U12_RS14650 (O6U12_14650) | 2725472..2725753 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
O6U12_RS14655 (O6U12_14655) | 2725869..2727038 | - | 1170 | WP_014478898.1 | alanine racemase | - |
O6U12_RS14660 (O6U12_14660) | 2727153..2728169 | - | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
O6U12_RS14665 (O6U12_14665) | 2728335..2728700 | - | 366 | WP_014478897.1 | holo-ACP synthase | - |
O6U12_RS14670 (O6U12_14670) | 2728795..2729394 | + | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T267043 WP_003156187.1 NZ_CP114899:c2725467-2725117 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|