Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1910818..1911734 | Replicon | chromosome |
Accession | NZ_CP114899 | ||
Organism | Bacillus subtilis strain |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | O6U12_RS10310 | Protein ID | WP_003244695.1 |
Coordinates | 1910818..1911564 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | O6U12_RS10315 | Protein ID | WP_003232646.1 |
Coordinates | 1911564..1911734 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6U12_RS10285 (O6U12_10285) | 1905936..1906037 | - | 102 | Protein_2025 | hypothetical protein | - |
O6U12_RS10290 (O6U12_10290) | 1906146..1907096 | - | 951 | WP_014476561.1 | ring-cleaving dioxygenase | - |
O6U12_RS10295 (O6U12_10295) | 1907485..1908801 | + | 1317 | WP_041333863.1 | serine/threonine exchanger | - |
O6U12_RS10300 (O6U12_10300) | 1909077..1909694 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
O6U12_RS10305 (O6U12_10305) | 1909707..1910708 | + | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
O6U12_RS10310 (O6U12_10310) | 1910818..1911564 | + | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
O6U12_RS10315 (O6U12_10315) | 1911564..1911734 | + | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
O6U12_RS10320 (O6U12_10320) | 1911820..1911957 | + | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
O6U12_RS10325 (O6U12_10325) | 1911995..1912888 | - | 894 | WP_014479567.1 | N-acetylmuramoyl-L-alanine amidase | - |
O6U12_RS10330 (O6U12_10330) | 1912901..1913164 | - | 264 | WP_003232653.1 | phage holin | - |
O6U12_RS10335 (O6U12_10335) | 1913177..1913446 | - | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
O6U12_RS10340 (O6U12_10340) | 1913499..1914337 | - | 839 | Protein_2036 | phage-like element PBSX protein XepA | - |
O6U12_RS10345 (O6U12_10345) | 1914381..1914545 | - | 165 | WP_087960875.1 | XkdX family protein | - |
O6U12_RS10350 (O6U12_10350) | 1914542..1914871 | - | 330 | WP_003232660.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T267042 WP_003244695.1 NZ_CP114899:1910818-1911564 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|