Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4472749..4473367 | Replicon | chromosome |
Accession | NZ_CP114896 | ||
Organism | Escherichia coli strain CM93 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | O6117_RS21905 | Protein ID | WP_001290581.1 |
Coordinates | 4472749..4472967 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | O6117_RS21910 | Protein ID | WP_000344800.1 |
Coordinates | 4472993..4473367 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6117_RS21870 (4468038) | 4468038..4468610 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
O6117_RS21875 (4468641) | 4468641..4468952 | - | 312 | WP_000409911.1 | MGMT family protein | - |
O6117_RS21885 (4469331) | 4469331..4469684 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
O6117_RS21890 (4469726) | 4469726..4471276 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
O6117_RS21895 (4471440) | 4471440..4471910 | - | 471 | WP_000136192.1 | YlaC family protein | - |
O6117_RS21900 (4472026) | 4472026..4472577 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
O6117_RS21905 (4472749) | 4472749..4472967 | - | 219 | WP_001290581.1 | HHA domain-containing protein | Toxin |
O6117_RS21910 (4472993) | 4472993..4473367 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
O6117_RS21915 (4473913) | 4473913..4477062 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
O6117_RS21920 (4477085) | 4477085..4478278 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T267041 WP_001290581.1 NZ_CP114896:c4472967-4472749 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT267041 WP_000344800.1 NZ_CP114896:c4473367-4472993 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|