Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 4290760..4291439 | Replicon | chromosome |
| Accession | NZ_CP114896 | ||
| Organism | Escherichia coli strain CM93 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | O6117_RS20940 | Protein ID | WP_000854672.1 |
| Coordinates | 4290760..4291101 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | O6117_RS20945 | Protein ID | WP_000070395.1 |
| Coordinates | 4291122..4291439 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6117_RS20915 (4286037) | 4286037..4286438 | + | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
| O6117_RS20920 (4286477) | 4286477..4287532 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| O6117_RS20925 (4287820) | 4287820..4288923 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| O6117_RS20930 (4288935) | 4288935..4290188 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| O6117_RS20940 (4290760) | 4290760..4291101 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| O6117_RS20945 (4291122) | 4291122..4291439 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| O6117_RS20950 (4291458) | 4291458..4291679 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| O6117_RS20955 (4291688) | 4291688..4292164 | - | 477 | WP_000811693.1 | RadC family protein | - |
| O6117_RS20960 (4292180) | 4292180..4292638 | - | 459 | WP_000211838.1 | antirestriction protein | - |
| O6117_RS20965 (4292736) | 4292736..4292975 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
| O6117_RS20970 (4293052) | 4293052..4293519 | - | 468 | WP_001547765.1 | protein YkfB | - |
| O6117_RS20975 (4293542) | 4293542..4293985 | - | 444 | WP_269707801.1 | lipoprotein YafY | - |
| O6117_RS20980 (4293985) | 4293985..4294212 | - | 228 | WP_001548158.1 | protein YpjK | - |
| O6117_RS20985 (4294208) | 4294208..4294399 | - | 192 | Protein_4076 | DeoR family transcriptional regulator | - |
| O6117_RS20990 (4294616) | 4294616..4295437 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| O6117_RS20995 (4295529) | 4295529..4296392 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T267040 WP_000854672.1 NZ_CP114896:c4291101-4290760 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|