Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 4290760..4291439 Replicon chromosome
Accession NZ_CP114896
Organism Escherichia coli strain CM93

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag O6117_RS20940 Protein ID WP_000854672.1
Coordinates 4290760..4291101 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag O6117_RS20945 Protein ID WP_000070395.1
Coordinates 4291122..4291439 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O6117_RS20915 (4286037) 4286037..4286438 + 402 WP_000174689.1 sigma factor-binding protein Crl -
O6117_RS20920 (4286477) 4286477..4287532 - 1056 WP_000749863.1 phosphoporin PhoE -
O6117_RS20925 (4287820) 4287820..4288923 + 1104 WP_001285288.1 glutamate 5-kinase -
O6117_RS20930 (4288935) 4288935..4290188 + 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
O6117_RS20940 (4290760) 4290760..4291101 - 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
O6117_RS20945 (4291122) 4291122..4291439 - 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
O6117_RS20950 (4291458) 4291458..4291679 - 222 WP_000691994.1 DUF987 domain-containing protein -
O6117_RS20955 (4291688) 4291688..4292164 - 477 WP_000811693.1 RadC family protein -
O6117_RS20960 (4292180) 4292180..4292638 - 459 WP_000211838.1 antirestriction protein -
O6117_RS20965 (4292736) 4292736..4292975 - 240 WP_000194654.1 DUF905 family protein -
O6117_RS20970 (4293052) 4293052..4293519 - 468 WP_001547765.1 protein YkfB -
O6117_RS20975 (4293542) 4293542..4293985 - 444 WP_269707801.1 lipoprotein YafY -
O6117_RS20980 (4293985) 4293985..4294212 - 228 WP_001548158.1 protein YpjK -
O6117_RS20985 (4294208) 4294208..4294399 - 192 Protein_4076 DeoR family transcriptional regulator -
O6117_RS20990 (4294616) 4294616..4295437 - 822 WP_000197389.1 DUF932 domain-containing protein -
O6117_RS20995 (4295529) 4295529..4296392 - 864 WP_001065553.1 GTPase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T267040 WP_000854672.1 NZ_CP114896:c4291101-4290760 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT267040 WP_000070395.1 NZ_CP114896:c4291439-4291122 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References