Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2498935..2499589 | Replicon | chromosome |
| Accession | NZ_CP114896 | ||
| Organism | Escherichia coli strain CM93 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | O6117_RS12245 | Protein ID | WP_000244777.1 |
| Coordinates | 2498935..2499342 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | O6117_RS12250 | Protein ID | WP_000354046.1 |
| Coordinates | 2499323..2499589 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6117_RS12225 (2494892) | 2494892..2496625 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| O6117_RS12230 (2496631) | 2496631..2497341 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| O6117_RS12235 (2497366) | 2497366..2498262 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| O6117_RS12240 (2498374) | 2498374..2498895 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| O6117_RS12245 (2498935) | 2498935..2499342 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
| O6117_RS12250 (2499323) | 2499323..2499589 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| O6117_RS12255 (2499832) | 2499832..2500812 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| O6117_RS12260 (2501008) | 2501008..2501667 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| O6117_RS12265 (2501831) | 2501831..2502142 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| O6117_RS12270 (2502187) | 2502187..2503620 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
| O6117_RS12275 (2503677) | 2503677..2504420 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T267031 WP_000244777.1 NZ_CP114896:c2499342-2498935 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |