Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2367948..2368531 | Replicon | chromosome |
Accession | NZ_CP114896 | ||
Organism | Escherichia coli strain CM93 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | O6117_RS11660 | Protein ID | WP_000254738.1 |
Coordinates | 2367948..2368283 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | O6117_RS11665 | Protein ID | WP_000581937.1 |
Coordinates | 2368283..2368531 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6117_RS11645 (2363835) | 2363835..2365133 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
O6117_RS11650 (2365221) | 2365221..2366858 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
O6117_RS11655 (2367086) | 2367086..2367877 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
O6117_RS11660 (2367948) | 2367948..2368283 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
O6117_RS11665 (2368283) | 2368283..2368531 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
O6117_RS11670 (2368609) | 2368609..2370588 | - | 1980 | Protein_2275 | GTP diphosphokinase | - |
O6117_RS11680 (2371919) | 2371919..2372179 | - | 261 | Protein_2277 | GTP diphosphokinase | - |
O6117_RS11685 (2372227) | 2372227..2373528 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T267030 WP_000254738.1 NZ_CP114896:c2368283-2367948 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|