Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1532774..1533605 | Replicon | chromosome |
Accession | NZ_CP114896 | ||
Organism | Escherichia coli strain CM93 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | O6117_RS07680 | Protein ID | WP_000854814.1 |
Coordinates | 1533231..1533605 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | P76364 |
Locus tag | O6117_RS07675 | Protein ID | WP_001285584.1 |
Coordinates | 1532774..1533142 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6117_RS07660 (1530441) | 1530441..1531973 | + | 1533 | WP_001350525.1 | protein YeeR | - |
O6117_RS07665 (1531970) | 1531970..1532416 | + | 447 | WP_000187523.1 | RadC family protein | - |
O6117_RS07670 (1532479) | 1532479..1532700 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
O6117_RS07675 (1532774) | 1532774..1533142 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
O6117_RS07680 (1533231) | 1533231..1533605 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
O6117_RS07685 (1533602) | 1533602..1533796 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
O6117_RS07690 (1533842) | 1533842..1533922 | + | 81 | Protein_1499 | hypothetical protein | - |
O6117_RS07695 (1534211) | 1534211..1534339 | - | 129 | Protein_1500 | transposase domain-containing protein | - |
O6117_RS07700 (1534459) | 1534459..1534593 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
O6117_RS07705 (1534694) | 1534694..1535023 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
O6117_RS07710 (1535195) | 1535195..1536253 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
O6117_RS07715 (1536451) | 1536451..1536924 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
O6117_RS07720 (1537043) | 1537043..1538209 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T267026 WP_000854814.1 NZ_CP114896:1533231-1533605 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT267026 WP_001285584.1 NZ_CP114896:1532774-1533142 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FY50 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2H28 | |
AlphaFold DB | A0A1M2E8G6 |