Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 965796..966434 | Replicon | chromosome |
| Accession | NZ_CP114896 | ||
| Organism | Escherichia coli strain CM93 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | O6117_RS04775 | Protein ID | WP_000813794.1 |
| Coordinates | 965796..965972 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | O6117_RS04780 | Protein ID | WP_001270286.1 |
| Coordinates | 966018..966434 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6117_RS04755 (961415) | 961415..962590 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| O6117_RS04760 (962682) | 962682..963218 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| O6117_RS04765 (963291) | 963291..965252 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| O6117_RS04770 (965344) | 965344..965574 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| O6117_RS04775 (965796) | 965796..965972 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| O6117_RS04780 (966018) | 966018..966434 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| O6117_RS04785 (966513) | 966513..967919 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| O6117_RS04790 (968164) | 968164..969309 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| O6117_RS04795 (969327) | 969327..970340 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| O6117_RS04800 (970341) | 970341..971282 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T267019 WP_000813794.1 NZ_CP114896:965796-965972 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT267019 WP_001270286.1 NZ_CP114896:966018-966434 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|