Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3552719..3553302 | Replicon | chromosome |
Accession | NZ_CP114895 | ||
Organism | Escherichia coli strain CM56 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | O6106_RS17485 | Protein ID | WP_000254738.1 |
Coordinates | 3552719..3553054 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | O6106_RS17490 | Protein ID | WP_000581937.1 |
Coordinates | 3553054..3553302 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6106_RS17470 (3548606) | 3548606..3549904 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
O6106_RS17475 (3549992) | 3549992..3551629 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
O6106_RS17480 (3551857) | 3551857..3552648 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
O6106_RS17485 (3552719) | 3552719..3553054 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
O6106_RS17490 (3553054) | 3553054..3553302 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
O6106_RS17495 (3553380) | 3553380..3555359 | - | 1980 | Protein_3395 | GTP diphosphokinase | - |
O6106_RS17505 (3556690) | 3556690..3556950 | - | 261 | Protein_3397 | GTP diphosphokinase | - |
O6106_RS17510 (3556998) | 3556998..3558299 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T267011 WP_000254738.1 NZ_CP114895:c3553054-3552719 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|