Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 3418301..3418968 | Replicon | chromosome |
| Accession | NZ_CP114895 | ||
| Organism | Escherichia coli strain CM56 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | Q46953 |
| Locus tag | O6106_RS16825 | Protein ID | WP_001094400.1 |
| Coordinates | 3418639..3418968 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | P52141 |
| Locus tag | O6106_RS16820 | Protein ID | WP_000072690.1 |
| Coordinates | 3418301..3418618 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6106_RS16790 (3413353) | 3413353..3414362 | - | 1010 | Protein_3260 | arsenic transporter | - |
| O6106_RS16795 (3414504) | 3414504..3416207 | + | 1704 | WP_000896263.1 | protein YfjW | - |
| O6106_RS16800 (3416818) | 3416818..3417002 | + | 185 | Protein_3262 | DUF905 family protein | - |
| O6106_RS16805 (3417105) | 3417105..3417563 | + | 459 | WP_000211841.1 | antirestriction protein | - |
| O6106_RS16810 (3417572) | 3417572..3418054 | + | 483 | WP_001407480.1 | RadC family protein | - |
| O6106_RS16815 (3418063) | 3418063..3418263 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
| O6106_RS16820 (3418301) | 3418301..3418618 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| O6106_RS16825 (3418639) | 3418639..3418968 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
| O6106_RS16830 (3419332) | 3419332..3423912 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T267010 WP_001094400.1 NZ_CP114895:3418639-3418968 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A373F4I3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2EA9 | |
| PDB | 2JN7 | |
| AlphaFold DB | P52141 |