Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2150566..2151204 | Replicon | chromosome |
| Accession | NZ_CP114895 | ||
| Organism | Escherichia coli strain CM56 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | O6106_RS10600 | Protein ID | WP_000813794.1 |
| Coordinates | 2150566..2150742 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | O6106_RS10605 | Protein ID | WP_001270286.1 |
| Coordinates | 2150788..2151204 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6106_RS10580 (2146185) | 2146185..2147360 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| O6106_RS10585 (2147452) | 2147452..2147988 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| O6106_RS10590 (2148061) | 2148061..2150022 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| O6106_RS10595 (2150114) | 2150114..2150344 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| O6106_RS10600 (2150566) | 2150566..2150742 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| O6106_RS10605 (2150788) | 2150788..2151204 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| O6106_RS10610 (2151283) | 2151283..2152689 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| O6106_RS10615 (2152934) | 2152934..2154079 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| O6106_RS10620 (2154097) | 2154097..2155110 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| O6106_RS10625 (2155111) | 2155111..2156052 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T267000 WP_000813794.1 NZ_CP114895:2150566-2150742 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT267000 WP_001270286.1 NZ_CP114895:2150788-2151204 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|