Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1084566..1085184 | Replicon | chromosome |
| Accession | NZ_CP114895 | ||
| Organism | Escherichia coli strain CM56 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | - |
| Locus tag | O6106_RS05310 | Protein ID | WP_001290581.1 |
| Coordinates | 1084566..1084784 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | O6106_RS05315 | Protein ID | WP_000344800.1 |
| Coordinates | 1084810..1085184 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6106_RS05275 (1079855) | 1079855..1080427 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
| O6106_RS05280 (1080458) | 1080458..1080769 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| O6106_RS05290 (1081148) | 1081148..1081501 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| O6106_RS05295 (1081543) | 1081543..1083093 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| O6106_RS05300 (1083257) | 1083257..1083727 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| O6106_RS05305 (1083843) | 1083843..1084394 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| O6106_RS05310 (1084566) | 1084566..1084784 | - | 219 | WP_001290581.1 | HHA domain-containing protein | Toxin |
| O6106_RS05315 (1084810) | 1084810..1085184 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| O6106_RS05320 (1085730) | 1085730..1088879 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| O6106_RS05325 (1088902) | 1088902..1090095 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T266996 WP_001290581.1 NZ_CP114895:c1084784-1084566 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT266996 WP_000344800.1 NZ_CP114895:c1085184-1084810 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|