Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 902577..903256 | Replicon | chromosome |
| Accession | NZ_CP114895 | ||
| Organism | Escherichia coli strain CM56 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | O6106_RS04345 | Protein ID | WP_000854672.1 |
| Coordinates | 902577..902918 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | O6106_RS04350 | Protein ID | WP_000070395.1 |
| Coordinates | 902939..903256 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6106_RS04320 (897854) | 897854..898255 | + | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
| O6106_RS04325 (898294) | 898294..899349 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| O6106_RS04330 (899637) | 899637..900740 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| O6106_RS04335 (900752) | 900752..902005 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| O6106_RS04345 (902577) | 902577..902918 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| O6106_RS04350 (902939) | 902939..903256 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| O6106_RS04355 (903275) | 903275..903496 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| O6106_RS04360 (903505) | 903505..903981 | - | 477 | WP_000811693.1 | RadC family protein | - |
| O6106_RS04365 (903997) | 903997..904455 | - | 459 | WP_000211838.1 | antirestriction protein | - |
| O6106_RS04370 (904553) | 904553..904792 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
| O6106_RS04375 (904869) | 904869..905336 | - | 468 | WP_001547765.1 | protein YkfB | - |
| O6106_RS04380 (905359) | 905359..905802 | - | 444 | WP_269707801.1 | lipoprotein YafY | - |
| O6106_RS04385 (905802) | 905802..906029 | - | 228 | WP_001548158.1 | protein YpjK | - |
| O6106_RS04390 (906025) | 906025..906216 | - | 192 | Protein_834 | DeoR family transcriptional regulator | - |
| O6106_RS04395 (906433) | 906433..907254 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| O6106_RS04400 (907346) | 907346..908209 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T266995 WP_000854672.1 NZ_CP114895:c902918-902577 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|