Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4375331..4375949 | Replicon | chromosome |
Accession | NZ_CP114894 | ||
Organism | Escherichia coli strain CM19 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | O6X69_RS21460 | Protein ID | WP_001290581.1 |
Coordinates | 4375331..4375549 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | O6X69_RS21465 | Protein ID | WP_000344800.1 |
Coordinates | 4375575..4375949 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6X69_RS21425 (4370620) | 4370620..4371192 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
O6X69_RS21430 (4371223) | 4371223..4371534 | - | 312 | WP_000409911.1 | MGMT family protein | - |
O6X69_RS21440 (4371913) | 4371913..4372266 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
O6X69_RS21445 (4372308) | 4372308..4373858 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
O6X69_RS21450 (4374022) | 4374022..4374492 | - | 471 | WP_000136192.1 | YlaC family protein | - |
O6X69_RS21455 (4374608) | 4374608..4375159 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
O6X69_RS21460 (4375331) | 4375331..4375549 | - | 219 | WP_001290581.1 | HHA domain-containing protein | Toxin |
O6X69_RS21465 (4375575) | 4375575..4375949 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
O6X69_RS21470 (4376495) | 4376495..4379644 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
O6X69_RS21475 (4379667) | 4379667..4380860 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T266989 WP_001290581.1 NZ_CP114894:c4375549-4375331 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT266989 WP_000344800.1 NZ_CP114894:c4375949-4375575 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|