Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 4192081..4192760 | Replicon | chromosome |
Accession | NZ_CP114894 | ||
Organism | Escherichia coli strain CM19 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | P77692 |
Locus tag | O6X69_RS20490 | Protein ID | WP_000854672.1 |
Coordinates | 4192081..4192422 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | Q47684 |
Locus tag | O6X69_RS20495 | Protein ID | WP_000070395.1 |
Coordinates | 4192443..4192760 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6X69_RS20465 (4187358) | 4187358..4187759 | + | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
O6X69_RS20470 (4187798) | 4187798..4188853 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
O6X69_RS20475 (4189141) | 4189141..4190244 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
O6X69_RS20480 (4190256) | 4190256..4191509 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
O6X69_RS20490 (4192081) | 4192081..4192422 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
O6X69_RS20495 (4192443) | 4192443..4192760 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
O6X69_RS20500 (4192779) | 4192779..4193000 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
O6X69_RS20505 (4193009) | 4193009..4193485 | - | 477 | WP_000811693.1 | RadC family protein | - |
O6X69_RS20510 (4193501) | 4193501..4193959 | - | 459 | WP_000211838.1 | antirestriction protein | - |
O6X69_RS20515 (4194057) | 4194057..4194296 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
O6X69_RS20520 (4194373) | 4194373..4194840 | - | 468 | WP_001547765.1 | protein YkfB | - |
O6X69_RS20525 (4194863) | 4194863..4195306 | - | 444 | WP_269707801.1 | lipoprotein YafY | - |
O6X69_RS20530 (4195306) | 4195306..4195533 | - | 228 | WP_001548158.1 | protein YpjK | - |
O6X69_RS20535 (4195529) | 4195529..4195720 | - | 192 | Protein_3986 | DeoR family transcriptional regulator | - |
O6X69_RS20540 (4195937) | 4195937..4196758 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
O6X69_RS20545 (4196850) | 4196850..4197713 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T266988 WP_000854672.1 NZ_CP114894:c4192422-4192081 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|