Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2268498..2269081 | Replicon | chromosome |
Accession | NZ_CP114894 | ||
Organism | Escherichia coli strain CM19 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | O6X69_RS11205 | Protein ID | WP_000254738.1 |
Coordinates | 2268498..2268833 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | O6X69_RS11210 | Protein ID | WP_000581937.1 |
Coordinates | 2268833..2269081 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6X69_RS11190 (2264385) | 2264385..2265683 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
O6X69_RS11195 (2265771) | 2265771..2267408 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
O6X69_RS11200 (2267636) | 2267636..2268427 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
O6X69_RS11205 (2268498) | 2268498..2268833 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
O6X69_RS11210 (2268833) | 2268833..2269081 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
O6X69_RS11215 (2269159) | 2269159..2271138 | - | 1980 | Protein_2184 | GTP diphosphokinase | - |
O6X69_RS11225 (2272469) | 2272469..2272729 | - | 261 | Protein_2186 | GTP diphosphokinase | - |
O6X69_RS11230 (2272777) | 2272777..2274078 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T266978 WP_000254738.1 NZ_CP114894:c2268833-2268498 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|