Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 861796..862434 | Replicon | chromosome |
| Accession | NZ_CP114894 | ||
| Organism | Escherichia coli strain CM19 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | O6X69_RS04300 | Protein ID | WP_000813794.1 |
| Coordinates | 861796..861972 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | O6X69_RS04305 | Protein ID | WP_001270286.1 |
| Coordinates | 862018..862434 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6X69_RS04280 (857415) | 857415..858590 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| O6X69_RS04285 (858682) | 858682..859218 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| O6X69_RS04290 (859291) | 859291..861252 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| O6X69_RS04295 (861344) | 861344..861574 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| O6X69_RS04300 (861796) | 861796..861972 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| O6X69_RS04305 (862018) | 862018..862434 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| O6X69_RS04310 (862513) | 862513..863919 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| O6X69_RS04315 (864164) | 864164..865309 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| O6X69_RS04320 (865327) | 865327..866340 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| O6X69_RS04325 (866341) | 866341..867282 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T266967 WP_000813794.1 NZ_CP114894:861796-861972 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT266967 WP_001270286.1 NZ_CP114894:862018-862434 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|