Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3038756..3039587 | Replicon | chromosome |
| Accession | NZ_CP114893 | ||
| Organism | Escherichia coli strain CM13 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | O6R07_RS14715 | Protein ID | WP_000854814.1 |
| Coordinates | 3038756..3039130 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | O6R07_RS14720 | Protein ID | WP_001285584.1 |
| Coordinates | 3039219..3039587 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6R07_RS14675 (3034152) | 3034152..3035318 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| O6R07_RS14680 (3035437) | 3035437..3035910 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| O6R07_RS14685 (3036108) | 3036108..3037166 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| O6R07_RS14690 (3037338) | 3037338..3037667 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| O6R07_RS14695 (3037768) | 3037768..3037902 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| O6R07_RS14700 (3038022) | 3038022..3038150 | + | 129 | Protein_2855 | transposase domain-containing protein | - |
| O6R07_RS14705 (3038439) | 3038439..3038519 | - | 81 | Protein_2856 | hypothetical protein | - |
| O6R07_RS14710 (3038565) | 3038565..3038759 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| O6R07_RS14715 (3038756) | 3038756..3039130 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| O6R07_RS14720 (3039219) | 3039219..3039587 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| O6R07_RS14725 (3039661) | 3039661..3039882 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| O6R07_RS14730 (3039945) | 3039945..3040391 | - | 447 | WP_000187523.1 | RadC family protein | - |
| O6R07_RS14735 (3040388) | 3040388..3041920 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T266956 WP_000854814.1 NZ_CP114893:c3039130-3038756 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT266956 WP_001285584.1 NZ_CP114893:c3039587-3039219 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |