Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 2198705..2199288 | Replicon | chromosome |
| Accession | NZ_CP114893 | ||
| Organism | Escherichia coli strain CM13 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | O6R07_RS10715 | Protein ID | WP_000254738.1 |
| Coordinates | 2198953..2199288 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | O6R07_RS10710 | Protein ID | WP_000581937.1 |
| Coordinates | 2198705..2198953 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6R07_RS10690 (2193708) | 2193708..2195009 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| O6R07_RS10695 (2195057) | 2195057..2195317 | + | 261 | Protein_2074 | GTP diphosphokinase | - |
| O6R07_RS10700 (2195408) | 2195408..2196636 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
| O6R07_RS10705 (2196648) | 2196648..2198627 | + | 1980 | Protein_2076 | GTP diphosphokinase | - |
| O6R07_RS10710 (2198705) | 2198705..2198953 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| O6R07_RS10715 (2198953) | 2198953..2199288 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| O6R07_RS10720 (2199359) | 2199359..2200150 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| O6R07_RS10725 (2200378) | 2200378..2202015 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| O6R07_RS10730 (2202103) | 2202103..2203401 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T266952 WP_000254738.1 NZ_CP114893:2198953-2199288 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|