Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 566740..567554 | Replicon | chromosome |
Accession | NZ_CP114893 | ||
Organism | Escherichia coli strain CM13 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | O6R07_RS02860 | Protein ID | WP_001054376.1 |
Coordinates | 566740..566997 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | O6R07_RS02865 | Protein ID | WP_001309181.1 |
Coordinates | 567009..567554 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6R07_RS02835 (562028) | 562028..563134 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
O6R07_RS02840 (563199) | 563199..564179 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
O6R07_RS02845 (564289) | 564289..564494 | + | 206 | Protein_555 | HNH endonuclease | - |
O6R07_RS02850 (564762) | 564762..566002 | - | 1241 | Protein_556 | helicase YjhR | - |
O6R07_RS02855 (566118) | 566118..566249 | + | 132 | WP_001309182.1 | hypothetical protein | - |
O6R07_RS02860 (566740) | 566740..566997 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
O6R07_RS02865 (567009) | 567009..567554 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
O6R07_RS02870 (567610) | 567610..568356 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
O6R07_RS02875 (568525) | 568525..568743 | + | 219 | Protein_561 | hypothetical protein | - |
O6R07_RS02880 (568781) | 568781..568897 | + | 117 | Protein_562 | VOC family protein | - |
O6R07_RS02885 (569142) | 569142..570263 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
O6R07_RS02890 (570260) | 570260..570538 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
O6R07_RS02895 (570550) | 570550..571863 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 551937..575778 | 23841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T266945 WP_001054376.1 NZ_CP114893:566740-566997 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT266945 WP_001309181.1 NZ_CP114893:567009-567554 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|