Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 275813..276492 | Replicon | chromosome |
| Accession | NZ_CP114893 | ||
| Organism | Escherichia coli strain CM13 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | O6R07_RS01435 | Protein ID | WP_000854672.1 |
| Coordinates | 276151..276492 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | O6R07_RS01430 | Protein ID | WP_000070395.1 |
| Coordinates | 275813..276130 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6R07_RS01380 (270860) | 270860..271723 | + | 864 | WP_001065553.1 | GTPase family protein | - |
| O6R07_RS01385 (271815) | 271815..272636 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| O6R07_RS01390 (272853) | 272853..273044 | + | 192 | Protein_275 | DeoR family transcriptional regulator | - |
| O6R07_RS01395 (273040) | 273040..273267 | + | 228 | WP_001548158.1 | protein YpjK | - |
| O6R07_RS01400 (273267) | 273267..273710 | + | 444 | WP_269707801.1 | lipoprotein YafY | - |
| O6R07_RS01405 (273733) | 273733..274200 | + | 468 | WP_001547765.1 | protein YkfB | - |
| O6R07_RS01410 (274277) | 274277..274516 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| O6R07_RS01415 (274614) | 274614..275072 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| O6R07_RS01420 (275088) | 275088..275564 | + | 477 | WP_000811693.1 | RadC family protein | - |
| O6R07_RS01425 (275573) | 275573..275794 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| O6R07_RS01430 (275813) | 275813..276130 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| O6R07_RS01435 (276151) | 276151..276492 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| O6R07_RS01445 (277064) | 277064..278317 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| O6R07_RS01450 (278329) | 278329..279432 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| O6R07_RS01455 (279720) | 279720..280775 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| O6R07_RS01460 (280814) | 280814..281215 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T266942 WP_000854672.1 NZ_CP114893:276151-276492 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|