Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4240341..4240959 | Replicon | chromosome |
Accession | NZ_CP114892 | ||
Organism | Escherichia coli strain CM5 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | O6Q95_RS20795 | Protein ID | WP_001290581.1 |
Coordinates | 4240341..4240559 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | O6Q95_RS20800 | Protein ID | WP_000344800.1 |
Coordinates | 4240585..4240959 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q95_RS20760 (4235630) | 4235630..4236202 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
O6Q95_RS20765 (4236233) | 4236233..4236544 | - | 312 | WP_000409911.1 | MGMT family protein | - |
O6Q95_RS20775 (4236923) | 4236923..4237276 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
O6Q95_RS20780 (4237318) | 4237318..4238868 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
O6Q95_RS20785 (4239032) | 4239032..4239502 | - | 471 | WP_000136192.1 | YlaC family protein | - |
O6Q95_RS20790 (4239618) | 4239618..4240169 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
O6Q95_RS20795 (4240341) | 4240341..4240559 | - | 219 | WP_001290581.1 | HHA domain-containing protein | Toxin |
O6Q95_RS20800 (4240585) | 4240585..4240959 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
O6Q95_RS20805 (4241505) | 4241505..4244654 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
O6Q95_RS20810 (4244677) | 4244677..4245870 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T266940 WP_001290581.1 NZ_CP114892:c4240559-4240341 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT266940 WP_000344800.1 NZ_CP114892:c4240959-4240585 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|