Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 4058352..4059031 Replicon chromosome
Accession NZ_CP114892
Organism Escherichia coli strain CM5

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag O6Q95_RS19830 Protein ID WP_000854672.1
Coordinates 4058352..4058693 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag O6Q95_RS19835 Protein ID WP_000070395.1
Coordinates 4058714..4059031 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O6Q95_RS19805 (4053629) 4053629..4054030 + 402 WP_000174689.1 sigma factor-binding protein Crl -
O6Q95_RS19810 (4054069) 4054069..4055124 - 1056 WP_000749863.1 phosphoporin PhoE -
O6Q95_RS19815 (4055412) 4055412..4056515 + 1104 WP_001285288.1 glutamate 5-kinase -
O6Q95_RS19820 (4056527) 4056527..4057780 + 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
O6Q95_RS19830 (4058352) 4058352..4058693 - 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
O6Q95_RS19835 (4058714) 4058714..4059031 - 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
O6Q95_RS19840 (4059050) 4059050..4059271 - 222 WP_000691994.1 DUF987 domain-containing protein -
O6Q95_RS19845 (4059280) 4059280..4059756 - 477 WP_000811693.1 RadC family protein -
O6Q95_RS19850 (4059772) 4059772..4060230 - 459 WP_000211838.1 antirestriction protein -
O6Q95_RS19855 (4060328) 4060328..4060567 - 240 WP_000194654.1 DUF905 family protein -
O6Q95_RS19860 (4060644) 4060644..4061111 - 468 WP_001547765.1 protein YkfB -
O6Q95_RS19865 (4061134) 4061134..4061577 - 444 WP_269707801.1 lipoprotein YafY -
O6Q95_RS19870 (4061577) 4061577..4061804 - 228 WP_001548158.1 protein YpjK -
O6Q95_RS19875 (4061800) 4061800..4061991 - 192 Protein_3869 DeoR family transcriptional regulator -
O6Q95_RS19880 (4062208) 4062208..4063029 - 822 WP_000197389.1 DUF932 domain-containing protein -
O6Q95_RS19885 (4063121) 4063121..4063984 - 864 WP_001065553.1 GTPase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T266939 WP_000854672.1 NZ_CP114892:c4058693-4058352 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT266939 WP_000070395.1 NZ_CP114892:c4059031-4058714 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References