Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 2135541..2136124 | Replicon | chromosome |
| Accession | NZ_CP114892 | ||
| Organism | Escherichia coli strain CM5 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | O6Q95_RS10550 | Protein ID | WP_000254738.1 |
| Coordinates | 2135541..2135876 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | O6Q95_RS10555 | Protein ID | WP_000581937.1 |
| Coordinates | 2135876..2136124 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6Q95_RS10535 (2131436) | 2131436..2132726 | - | 1291 | Protein_2063 | phosphopyruvate hydratase | - |
| O6Q95_RS10540 (2132814) | 2132814..2134451 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| O6Q95_RS10545 (2134679) | 2134679..2135470 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| O6Q95_RS10550 (2135541) | 2135541..2135876 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| O6Q95_RS10555 (2135876) | 2135876..2136124 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| O6Q95_RS10560 (2136202) | 2136202..2138181 | - | 1980 | Protein_2068 | GTP diphosphokinase | - |
| O6Q95_RS10570 (2139512) | 2139512..2139772 | - | 261 | Protein_2070 | GTP diphosphokinase | - |
| O6Q95_RS10575 (2139820) | 2139820..2141121 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T266929 WP_000254738.1 NZ_CP114892:c2135876-2135541 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|