Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1295248..1296079 | Replicon | chromosome |
| Accession | NZ_CP114892 | ||
| Organism | Escherichia coli strain CM5 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | O6Q95_RS06540 | Protein ID | WP_000854814.1 |
| Coordinates | 1295705..1296079 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | O6Q95_RS06535 | Protein ID | WP_001285584.1 |
| Coordinates | 1295248..1295616 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6Q95_RS06520 (1292915) | 1292915..1294447 | + | 1533 | WP_001350525.1 | protein YeeR | - |
| O6Q95_RS06525 (1294444) | 1294444..1294890 | + | 447 | WP_000187523.1 | RadC family protein | - |
| O6Q95_RS06530 (1294953) | 1294953..1295174 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| O6Q95_RS06535 (1295248) | 1295248..1295616 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| O6Q95_RS06540 (1295705) | 1295705..1296079 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| O6Q95_RS06545 (1296076) | 1296076..1296270 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| O6Q95_RS06550 (1296316) | 1296316..1296396 | + | 81 | Protein_1286 | hypothetical protein | - |
| O6Q95_RS06555 (1296685) | 1296685..1296813 | - | 129 | Protein_1287 | transposase domain-containing protein | - |
| O6Q95_RS06560 (1296933) | 1296933..1297067 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| O6Q95_RS06565 (1297168) | 1297168..1297497 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| O6Q95_RS06570 (1297669) | 1297669..1298727 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| O6Q95_RS06575 (1298925) | 1298925..1299398 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| O6Q95_RS06580 (1299517) | 1299517..1300683 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T266925 WP_000854814.1 NZ_CP114892:1295705-1296079 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT266925 WP_001285584.1 NZ_CP114892:1295248-1295616 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |