Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 728266..728904 | Replicon | chromosome |
Accession | NZ_CP114892 | ||
Organism | Escherichia coli strain CM5 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | O6Q95_RS03635 | Protein ID | WP_000813794.1 |
Coordinates | 728266..728442 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | O6Q95_RS03640 | Protein ID | WP_001270286.1 |
Coordinates | 728488..728904 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q95_RS03615 (723885) | 723885..725060 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
O6Q95_RS03620 (725152) | 725152..725688 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
O6Q95_RS03625 (725761) | 725761..727722 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
O6Q95_RS03630 (727814) | 727814..728044 | - | 231 | WP_000494244.1 | YncJ family protein | - |
O6Q95_RS03635 (728266) | 728266..728442 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
O6Q95_RS03640 (728488) | 728488..728904 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
O6Q95_RS03645 (728983) | 728983..730389 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
O6Q95_RS03650 (730634) | 730634..731779 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
O6Q95_RS03655 (731797) | 731797..732810 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
O6Q95_RS03660 (732811) | 732811..733752 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T266918 WP_000813794.1 NZ_CP114892:728266-728442 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT266918 WP_001270286.1 NZ_CP114892:728488-728904 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|