Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3486813..3487408 | Replicon | chromosome |
Accession | NZ_CP114891 | ||
Organism | Escherichia coli strain CM2 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9XNP6 |
Locus tag | O6Q44_RS17245 | Protein ID | WP_000239577.1 |
Coordinates | 3486813..3487163 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | O6Q44_RS17250 | Protein ID | WP_001223208.1 |
Coordinates | 3487157..3487408 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q44_RS17225 (3483150) | 3483150..3483281 | - | 132 | Protein_3362 | ABC transporter permease | - |
O6Q44_RS17230 (3483295) | 3483295..3484797 | - | 1503 | WP_000205805.1 | sugar ABC transporter ATP-binding protein | - |
O6Q44_RS17235 (3484937) | 3484937..3485893 | - | 957 | WP_000265913.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
O6Q44_RS17240 (3486203) | 3486203..3486733 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
O6Q44_RS17245 (3486813) | 3486813..3487163 | - | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
O6Q44_RS17250 (3487157) | 3487157..3487408 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
O6Q44_RS17255 (3487620) | 3487620..3487961 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
O6Q44_RS17260 (3487964) | 3487964..3491743 | - | 3780 | WP_000060911.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T266913 WP_000239577.1 NZ_CP114891:c3487163-3486813 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XNP6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |