Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3400355..3401169 | Replicon | chromosome |
Accession | NZ_CP114891 | ||
Organism | Escherichia coli strain CM2 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | O6Q44_RS16805 | Protein ID | WP_001054376.1 |
Coordinates | 3400355..3400612 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | O6Q44_RS16810 | Protein ID | WP_001309181.1 |
Coordinates | 3400624..3401169 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q44_RS16780 (3395643) | 3395643..3396749 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
O6Q44_RS16785 (3396814) | 3396814..3397794 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
O6Q44_RS16790 (3397904) | 3397904..3398109 | + | 206 | Protein_3276 | HNH endonuclease | - |
O6Q44_RS16795 (3398377) | 3398377..3399617 | - | 1241 | Protein_3277 | helicase YjhR | - |
O6Q44_RS16800 (3399733) | 3399733..3399864 | + | 132 | WP_001309182.1 | hypothetical protein | - |
O6Q44_RS16805 (3400355) | 3400355..3400612 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
O6Q44_RS16810 (3400624) | 3400624..3401169 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
O6Q44_RS16815 (3401225) | 3401225..3401971 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
O6Q44_RS16820 (3402140) | 3402140..3402358 | + | 219 | Protein_3282 | hypothetical protein | - |
O6Q44_RS16825 (3402396) | 3402396..3402512 | + | 117 | Protein_3283 | VOC family protein | - |
O6Q44_RS16830 (3402757) | 3402757..3403878 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
O6Q44_RS16835 (3403875) | 3403875..3404153 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
O6Q44_RS16840 (3404165) | 3404165..3405478 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3385552..3409393 | 23841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T266912 WP_001054376.1 NZ_CP114891:3400355-3400612 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT266912 WP_001309181.1 NZ_CP114891:3400624-3401169 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|