Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3109428..3110107 | Replicon | chromosome |
| Accession | NZ_CP114891 | ||
| Organism | Escherichia coli strain CM2 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | O6Q44_RS15380 | Protein ID | WP_000854672.1 |
| Coordinates | 3109766..3110107 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | O6Q44_RS15375 | Protein ID | WP_000070395.1 |
| Coordinates | 3109428..3109745 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6Q44_RS15325 (3104475) | 3104475..3105338 | + | 864 | WP_001065553.1 | GTPase family protein | - |
| O6Q44_RS15330 (3105430) | 3105430..3106251 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| O6Q44_RS15335 (3106468) | 3106468..3106659 | + | 192 | Protein_2996 | DeoR family transcriptional regulator | - |
| O6Q44_RS15340 (3106655) | 3106655..3106882 | + | 228 | WP_001548158.1 | protein YpjK | - |
| O6Q44_RS15345 (3106882) | 3106882..3107325 | + | 444 | WP_269707801.1 | lipoprotein YafY | - |
| O6Q44_RS15350 (3107348) | 3107348..3107815 | + | 468 | WP_001547765.1 | protein YkfB | - |
| O6Q44_RS15355 (3107892) | 3107892..3108131 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| O6Q44_RS15360 (3108229) | 3108229..3108687 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| O6Q44_RS15365 (3108703) | 3108703..3109179 | + | 477 | WP_000811693.1 | RadC family protein | - |
| O6Q44_RS15370 (3109188) | 3109188..3109409 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| O6Q44_RS15375 (3109428) | 3109428..3109745 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| O6Q44_RS15380 (3109766) | 3109766..3110107 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| O6Q44_RS15390 (3110679) | 3110679..3111932 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| O6Q44_RS15395 (3111944) | 3111944..3113047 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| O6Q44_RS15400 (3113335) | 3113335..3114390 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| O6Q44_RS15405 (3114429) | 3114429..3114830 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T266909 WP_000854672.1 NZ_CP114891:3109766-3110107 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|