Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3109428..3110107 Replicon chromosome
Accession NZ_CP114891
Organism Escherichia coli strain CM2

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag O6Q44_RS15380 Protein ID WP_000854672.1
Coordinates 3109766..3110107 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag O6Q44_RS15375 Protein ID WP_000070395.1
Coordinates 3109428..3109745 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O6Q44_RS15325 (3104475) 3104475..3105338 + 864 WP_001065553.1 GTPase family protein -
O6Q44_RS15330 (3105430) 3105430..3106251 + 822 WP_000197389.1 DUF932 domain-containing protein -
O6Q44_RS15335 (3106468) 3106468..3106659 + 192 Protein_2996 DeoR family transcriptional regulator -
O6Q44_RS15340 (3106655) 3106655..3106882 + 228 WP_001548158.1 protein YpjK -
O6Q44_RS15345 (3106882) 3106882..3107325 + 444 WP_269707801.1 lipoprotein YafY -
O6Q44_RS15350 (3107348) 3107348..3107815 + 468 WP_001547765.1 protein YkfB -
O6Q44_RS15355 (3107892) 3107892..3108131 + 240 WP_000194654.1 DUF905 family protein -
O6Q44_RS15360 (3108229) 3108229..3108687 + 459 WP_000211838.1 antirestriction protein -
O6Q44_RS15365 (3108703) 3108703..3109179 + 477 WP_000811693.1 RadC family protein -
O6Q44_RS15370 (3109188) 3109188..3109409 + 222 WP_000691994.1 DUF987 domain-containing protein -
O6Q44_RS15375 (3109428) 3109428..3109745 + 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
O6Q44_RS15380 (3109766) 3109766..3110107 + 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
O6Q44_RS15390 (3110679) 3110679..3111932 - 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
O6Q44_RS15395 (3111944) 3111944..3113047 - 1104 WP_001285288.1 glutamate 5-kinase -
O6Q44_RS15400 (3113335) 3113335..3114390 + 1056 WP_000749863.1 phosphoporin PhoE -
O6Q44_RS15405 (3114429) 3114429..3114830 - 402 WP_000174689.1 sigma factor-binding protein Crl -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T266909 WP_000854672.1 NZ_CP114891:3109766-3110107 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT266909 WP_000070395.1 NZ_CP114891:3109428-3109745 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References