Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2927500..2928118 | Replicon | chromosome |
Accession | NZ_CP114891 | ||
Organism | Escherichia coli strain CM2 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | O6Q44_RS14415 | Protein ID | WP_001290581.1 |
Coordinates | 2927900..2928118 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | O6Q44_RS14410 | Protein ID | WP_000344800.1 |
Coordinates | 2927500..2927874 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q44_RS14400 (2922589) | 2922589..2923782 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
O6Q44_RS14405 (2923805) | 2923805..2926954 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
O6Q44_RS14410 (2927500) | 2927500..2927874 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
O6Q44_RS14415 (2927900) | 2927900..2928118 | + | 219 | WP_001290581.1 | HHA domain-containing protein | Toxin |
O6Q44_RS14420 (2928290) | 2928290..2928841 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
O6Q44_RS14425 (2928957) | 2928957..2929427 | + | 471 | WP_000136192.1 | YlaC family protein | - |
O6Q44_RS14430 (2929591) | 2929591..2931141 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
O6Q44_RS14435 (2931183) | 2931183..2931536 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
O6Q44_RS14445 (2931915) | 2931915..2932226 | + | 312 | WP_000409911.1 | MGMT family protein | - |
O6Q44_RS14450 (2932257) | 2932257..2932829 | - | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T266908 WP_001290581.1 NZ_CP114891:2927900-2928118 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT266908 WP_000344800.1 NZ_CP114891:2927500-2927874 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|