Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1857084..1857722 | Replicon | chromosome |
| Accession | NZ_CP114891 | ||
| Organism | Escherichia coli strain CM2 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | O6Q44_RS09105 | Protein ID | WP_000813794.1 |
| Coordinates | 1857546..1857722 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | O6Q44_RS09100 | Protein ID | WP_001270286.1 |
| Coordinates | 1857084..1857500 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6Q44_RS09080 (1852236) | 1852236..1853177 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| O6Q44_RS09085 (1853178) | 1853178..1854191 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| O6Q44_RS09090 (1854209) | 1854209..1855354 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| O6Q44_RS09095 (1855599) | 1855599..1857005 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| O6Q44_RS09100 (1857084) | 1857084..1857500 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| O6Q44_RS09105 (1857546) | 1857546..1857722 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| O6Q44_RS09110 (1857944) | 1857944..1858174 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| O6Q44_RS09115 (1858266) | 1858266..1860227 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| O6Q44_RS09120 (1860300) | 1860300..1860836 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| O6Q44_RS09125 (1860928) | 1860928..1862103 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T266907 WP_000813794.1 NZ_CP114891:c1857722-1857546 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT266907 WP_001270286.1 NZ_CP114891:c1857500-1857084 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|