Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1289913..1290744 | Replicon | chromosome |
| Accession | NZ_CP114891 | ||
| Organism | Escherichia coli strain CM2 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | O6Q44_RS06200 | Protein ID | WP_000854814.1 |
| Coordinates | 1289913..1290287 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | O6Q44_RS06205 | Protein ID | WP_001285584.1 |
| Coordinates | 1290376..1290744 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6Q44_RS06160 (1285309) | 1285309..1286475 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| O6Q44_RS06165 (1286594) | 1286594..1287067 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| O6Q44_RS06170 (1287265) | 1287265..1288323 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| O6Q44_RS06175 (1288495) | 1288495..1288824 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| O6Q44_RS06180 (1288925) | 1288925..1289059 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| O6Q44_RS06185 (1289179) | 1289179..1289307 | + | 129 | Protein_1206 | transposase domain-containing protein | - |
| O6Q44_RS06190 (1289596) | 1289596..1289676 | - | 81 | Protein_1207 | hypothetical protein | - |
| O6Q44_RS06195 (1289722) | 1289722..1289916 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| O6Q44_RS06200 (1289913) | 1289913..1290287 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| O6Q44_RS06205 (1290376) | 1290376..1290744 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| O6Q44_RS06210 (1290818) | 1290818..1291039 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| O6Q44_RS06215 (1291102) | 1291102..1291548 | - | 447 | WP_000187523.1 | RadC family protein | - |
| O6Q44_RS06220 (1291545) | 1291545..1293077 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T266900 WP_000854814.1 NZ_CP114891:c1290287-1289913 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT266900 WP_001285584.1 NZ_CP114891:c1290744-1290376 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |