Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 589319..589986 | Replicon | chromosome |
Accession | NZ_CP114891 | ||
Organism | Escherichia coli strain CM2 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | O6Q44_RS02880 | Protein ID | WP_001094400.1 |
Coordinates | 589319..589648 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | O6Q44_RS02885 | Protein ID | WP_000072690.1 |
Coordinates | 589669..589986 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q44_RS02875 (584375) | 584375..588955 | + | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
O6Q44_RS02880 (589319) | 589319..589648 | - | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
O6Q44_RS02885 (589669) | 589669..589986 | - | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
O6Q44_RS02890 (590024) | 590024..590224 | - | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
O6Q44_RS02895 (590233) | 590233..590715 | - | 483 | WP_001407480.1 | RadC family protein | - |
O6Q44_RS02900 (590724) | 590724..591182 | - | 459 | WP_000211841.1 | antirestriction protein | - |
O6Q44_RS02905 (591285) | 591285..591469 | - | 185 | Protein_564 | DUF905 family protein | - |
O6Q44_RS02910 (592080) | 592080..593783 | - | 1704 | WP_000896263.1 | protein YfjW | - |
O6Q44_RS02915 (593925) | 593925..594934 | + | 1010 | Protein_566 | arsenic transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T266897 WP_001094400.1 NZ_CP114891:c589648-589319 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |