Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 450908..451491 | Replicon | chromosome |
| Accession | NZ_CP114891 | ||
| Organism | Escherichia coli strain CM2 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | O6Q44_RS02205 | Protein ID | WP_000254738.1 |
| Coordinates | 451156..451491 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | O6Q44_RS02200 | Protein ID | WP_000581937.1 |
| Coordinates | 450908..451156 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6Q44_RS02180 (445911) | 445911..447212 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| O6Q44_RS02185 (447260) | 447260..447520 | + | 261 | Protein_426 | GTP diphosphokinase | - |
| O6Q44_RS02190 (447611) | 447611..448839 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
| O6Q44_RS02195 (448851) | 448851..450830 | + | 1980 | Protein_428 | GTP diphosphokinase | - |
| O6Q44_RS02200 (450908) | 450908..451156 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| O6Q44_RS02205 (451156) | 451156..451491 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| O6Q44_RS02210 (451562) | 451562..452353 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| O6Q44_RS02215 (452581) | 452581..454218 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| O6Q44_RS02220 (454306) | 454306..455604 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T266896 WP_000254738.1 NZ_CP114891:451156-451491 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|