Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 5989018..5989684 | Replicon | chromosome |
Accession | NZ_CP114886 | ||
Organism | Endozoicomonas sp. GU-1 strain Ap1-3 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | O2T12_RS25055 | Protein ID | WP_269671943.1 |
Coordinates | 5989018..5989395 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | O2T12_RS25060 | Protein ID | WP_269671944.1 |
Coordinates | 5989397..5989684 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O2T12_RS25030 (O2T12_25030) | 5985661..5986830 | + | 1170 | WP_269675990.1 | nucleotide sugar dehydrogenase | - |
O2T12_RS25035 (O2T12_25035) | 5987091..5987519 | + | 429 | WP_269671939.1 | nucleotidyltransferase substrate binding protein | - |
O2T12_RS25040 (O2T12_25040) | 5987519..5987848 | + | 330 | WP_269671940.1 | nucleotidyltransferase domain-containing protein | - |
O2T12_RS25045 (O2T12_25045) | 5988169..5988459 | + | 291 | WP_269671941.1 | nucleotidyltransferase family protein | - |
O2T12_RS25050 (O2T12_25050) | 5988456..5988821 | + | 366 | WP_269671942.1 | DUF86 domain-containing protein | - |
O2T12_RS25055 (O2T12_25055) | 5989018..5989395 | + | 378 | WP_269671943.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O2T12_RS25060 (O2T12_25060) | 5989397..5989684 | + | 288 | WP_269671944.1 | putative addiction module antidote protein | Antitoxin |
O2T12_RS25065 (O2T12_25065) | 5989846..5990145 | + | 300 | WP_269671945.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
O2T12_RS25070 (O2T12_25070) | 5990181..5990633 | + | 453 | WP_269671946.1 | winged helix-turn-helix domain-containing protein | - |
O2T12_RS25075 (O2T12_25075) | 5990660..5991220 | + | 561 | WP_269675991.1 | IS630 family transposase | - |
O2T12_RS25080 (O2T12_25080) | 5991239..5991364 | + | 126 | WP_269671947.1 | hypothetical protein | - |
O2T12_RS25085 (O2T12_25085) | 5991358..5991654 | + | 297 | WP_269675992.1 | hypothetical protein | - |
O2T12_RS25090 (O2T12_25090) | 5991756..5993012 | + | 1257 | WP_269671948.1 | hypothetical protein | - |
O2T12_RS25095 (O2T12_25095) | 5993018..5993932 | + | 915 | WP_269676662.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14379.75 Da Isoelectric Point: 9.8022
>T266890 WP_269671943.1 NZ_CP114886:5989018-5989395 [Endozoicomonas sp. GU-1]
MKDLTPGFFPFFVCELEYVSKWIHNSLMYLLKTTDHFEKWLHKLKDKQGKARILASLKLLEQGHIGDWKSVGGKVSELRV
HYGAGYRIYFARQEDVIIVLLNGGDKASQSRDIEKAKAILKNLEA
MKDLTPGFFPFFVCELEYVSKWIHNSLMYLLKTTDHFEKWLHKLKDKQGKARILASLKLLEQGHIGDWKSVGGKVSELRV
HYGAGYRIYFARQEDVIIVLLNGGDKASQSRDIEKAKAILKNLEA
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|