Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ParE-CopA/RHH(antitoxin) |
| Location | 5961971..5962527 | Replicon | chromosome |
| Accession | NZ_CP114886 | ||
| Organism | Endozoicomonas sp. GU-1 strain Ap1-3 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | O2T12_RS24885 | Protein ID | WP_269671914.1 |
| Coordinates | 5961971..5962267 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | copA | Uniprot ID | - |
| Locus tag | O2T12_RS24890 | Protein ID | WP_163369309.1 |
| Coordinates | 5962264..5962527 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O2T12_RS24855 (O2T12_24855) | 5957974..5958723 | - | 750 | WP_269671909.1 | hypothetical protein | - |
| O2T12_RS24860 (O2T12_24860) | 5958833..5960437 | - | 1605 | WP_269671910.1 | hypothetical protein | - |
| O2T12_RS24865 (O2T12_24865) | 5960413..5960772 | - | 360 | WP_269671911.1 | hypothetical protein | - |
| O2T12_RS24870 (O2T12_24870) | 5960775..5961023 | - | 249 | WP_101745988.1 | hypothetical protein | - |
| O2T12_RS24875 (O2T12_24875) | 5961103..5961414 | - | 312 | WP_269676654.1 | 3TM-type holin | - |
| O2T12_RS24880 (O2T12_24880) | 5961425..5961823 | - | 399 | WP_269671913.1 | M15 family metallopeptidase | - |
| O2T12_RS24885 (O2T12_24885) | 5961971..5962267 | - | 297 | WP_269671914.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O2T12_RS24890 (O2T12_24890) | 5962264..5962527 | - | 264 | WP_163369309.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| O2T12_RS24895 (O2T12_24895) | 5962583..5963119 | - | 537 | WP_269671915.1 | hypothetical protein | - |
| O2T12_RS24900 (O2T12_24900) | 5963129..5964496 | - | 1368 | WP_269676655.1 | DNA cytosine methyltransferase | - |
| O2T12_RS24905 (O2T12_24905) | 5964510..5964992 | - | 483 | WP_269671917.1 | DUF1367 family protein | - |
| O2T12_RS24910 (O2T12_24910) | 5965081..5965638 | - | 558 | WP_269676656.1 | replication protein P | - |
| O2T12_RS24915 (O2T12_24915) | 5965589..5966740 | - | 1152 | WP_269676657.1 | hypothetical protein | - |
| O2T12_RS24920 (O2T12_24920) | 5966737..5967054 | - | 318 | WP_209277157.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 5940086..5978176 | 38090 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11616.54 Da Isoelectric Point: 9.8890
>T266889 WP_269671914.1 NZ_CP114886:c5962267-5961971 [Endozoicomonas sp. GU-1]
MKLRFSRSAVDDLKRLRQFIAEKNPPAAQRMAEYLVRKINNLCHQPNMGVLVGDKLNPRLRDLIIRDYKIRYLADDREVL
ILKIWHQKEADEISLDSE
MKLRFSRSAVDDLKRLRQFIAEKNPPAAQRMAEYLVRKINNLCHQPNMGVLVGDKLNPRLRDLIIRDYKIRYLADDREVL
ILKIWHQKEADEISLDSE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|