Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 5942822..5943444 | Replicon | chromosome |
Accession | NZ_CP114886 | ||
Organism | Endozoicomonas sp. GU-1 strain Ap1-3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O2T12_RS24760 | Protein ID | WP_269676652.1 |
Coordinates | 5942822..5943211 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | O2T12_RS24765 | Protein ID | WP_269671894.1 |
Coordinates | 5943223..5943444 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O2T12_RS24745 (O2T12_24745) | 5939504..5939686 | - | 183 | WP_269676651.1 | hypothetical protein | - |
O2T12_RS24750 (O2T12_24750) | 5939756..5939851 | - | 96 | WP_269675989.1 | hypothetical protein | - |
O2T12_RS24755 (O2T12_24755) | 5940086..5942482 | - | 2397 | WP_269671892.1 | exonuclease domain-containing protein | - |
O2T12_RS24760 (O2T12_24760) | 5942822..5943211 | - | 390 | WP_269676652.1 | PIN domain-containing protein | Toxin |
O2T12_RS24765 (O2T12_24765) | 5943223..5943444 | - | 222 | WP_269671894.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
O2T12_RS24770 (O2T12_24770) | 5943519..5943842 | + | 324 | WP_269671895.1 | hypothetical protein | - |
O2T12_RS24775 (O2T12_24775) | 5943963..5945216 | + | 1254 | WP_269671896.1 | ISL3 family transposase | - |
O2T12_RS24780 (O2T12_24780) | 5945660..5945935 | - | 276 | WP_163370563.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
O2T12_RS24785 (O2T12_24785) | 5945932..5946180 | - | 249 | WP_257266787.1 | ribbon-helix-helix protein, CopG family | - |
O2T12_RS24790 (O2T12_24790) | 5946566..5947156 | + | 591 | WP_269671897.1 | nucleotidyltransferase domain-containing protein | - |
O2T12_RS24795 (O2T12_24795) | 5947153..5947338 | + | 186 | WP_269671898.1 | hypothetical protein | - |
O2T12_RS24800 (O2T12_24800) | 5947447..5947848 | - | 402 | WP_269671899.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 5940086..5978176 | 38090 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14501.48 Da Isoelectric Point: 6.6383
>T266888 WP_269676652.1 NZ_CP114886:c5943211-5942822 [Endozoicomonas sp. GU-1]
MVDTDICIAVLKHNRPVIDKFIEHQGKVYVSSISCYELQFGIEKGDPEHRQGKESKLSFFLEGVNVIDFDGAAARESAKV
REELQRGQQIGAYDTLLAAHARSRGMVMVTHNQREFSRVPGLQLADWLG
MVDTDICIAVLKHNRPVIDKFIEHQGKVYVSSISCYELQFGIEKGDPEHRQGKESKLSFFLEGVNVIDFDGAAARESAKV
REELQRGQQIGAYDTLLAAHARSRGMVMVTHNQREFSRVPGLQLADWLG
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|