Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 5238812..5239295 Replicon chromosome
Accession NZ_CP114886
Organism Endozoicomonas sp. GU-1 strain Ap1-3

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag O2T12_RS21905 Protein ID WP_269676526.1
Coordinates 5238812..5239087 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag O2T12_RS21910 Protein ID WP_101748923.1
Coordinates 5239074..5239295 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O2T12_RS21885 (O2T12_21885) 5234278..5235309 + 1032 WP_269675674.1 porin -
O2T12_RS21890 (O2T12_21890) 5235768..5236106 - 339 WP_269675675.1 hypothetical protein -
O2T12_RS21895 (O2T12_21895) 5236099..5236338 - 240 WP_252023919.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
O2T12_RS21900 (O2T12_21900) 5237284..5238603 + 1320 WP_269675676.1 group II intron reverse transcriptase/maturase -
O2T12_RS21905 (O2T12_21905) 5238812..5239087 + 276 WP_269676526.1 BrnT family toxin Toxin
O2T12_RS21910 (O2T12_21910) 5239074..5239295 + 222 WP_101748923.1 CopG family transcriptional regulator Antitoxin
O2T12_RS21915 (O2T12_21915) 5239428..5239712 + 285 WP_241693369.1 type II toxin-antitoxin system RelE/ParE family toxin -
O2T12_RS21920 (O2T12_21920) 5239716..5239994 + 279 WP_269675678.1 putative addiction module antidote protein -
O2T12_RS21925 (O2T12_21925) 5240055..5240528 - 474 WP_269675679.1 DUF29 domain-containing protein -
O2T12_RS21930 (O2T12_21930) 5241009..5241332 - 324 WP_269675680.1 iron donor protein CyaY -
O2T12_RS21935 (O2T12_21935) 5241522..5241686 + 165 WP_269675681.1 lipoprotein -
O2T12_RS21940 (O2T12_21940) 5241743..5243020 + 1278 WP_269675682.1 diaminopimelate decarboxylase -
O2T12_RS21945 (O2T12_21945) 5243044..5243874 + 831 WP_269677259.1 diaminopimelate epimerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(8-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10756.19 Da        Isoelectric Point: 7.1348

>T266886 WP_269676526.1 NZ_CP114886:5238812-5239087 [Endozoicomonas sp. GU-1]
MGNTQFEYDEEKSLANKDKHGIDFVQAATLWEDDRLICLQSKVKTDEDRLLFIGQITTKHWTAIATQRRDCLRIILVRRS
RKNEVNLYESQ

Download         Length: 276 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8435.52 Da        Isoelectric Point: 5.0608

>AT266886 WP_101748923.1 NZ_CP114886:5239074-5239295 [Endozoicomonas sp. GU-1]
MKASDIDKKFDDGEDVLEFFDTDHPQRPNLAAKRVNIDFPAWVVNELDKEASAIGISRQALIKTWIVDRLRQH

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References