Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 5010377..5010816 Replicon chromosome
Accession NZ_CP114886
Organism Endozoicomonas sp. GU-1 strain Ap1-3

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag O2T12_RS20900 Protein ID WP_269675516.1
Coordinates 5010661..5010816 (+) Length 52 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag O2T12_RS20895 Protein ID WP_269675962.1
Coordinates 5010377..5010661 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O2T12_RS20870 (O2T12_20870) 5006186..5006899 - 714 WP_269675513.1 histidine utilization repressor -
O2T12_RS20875 (O2T12_20875) 5007094..5009013 + 1920 WP_269675514.1 imidazolonepropionase -
O2T12_RS20880 (O2T12_20880) 5008932..5009171 + 240 WP_269677255.1 arginase family protein -
O2T12_RS20885 (O2T12_20885) 5009098..5009313 + 216 WP_269677256.1 arginase family protein -
O2T12_RS20890 (O2T12_20890) 5009350..5009958 - 609 WP_269675515.1 hypothetical protein -
O2T12_RS20895 (O2T12_20895) 5010377..5010661 + 285 WP_269675962.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
O2T12_RS20900 (O2T12_20900) 5010661..5010816 + 156 WP_269675516.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O2T12_RS20910 (O2T12_20910) 5011668..5012147 - 480 WP_101745079.1 SsrA-binding protein SmpB -
O2T12_RS20915 (O2T12_20915) 5012659..5014017 + 1359 WP_101745080.1 sodium-dependent transporter -
O2T12_RS20920 (O2T12_20920) 5014104..5014535 + 432 WP_269675517.1 type II toxin-antitoxin system RatA family toxin -
O2T12_RS20925 (O2T12_20925) 5014528..5014854 + 327 WP_269675518.1 RnfH family protein -
O2T12_RS20930 (O2T12_20930) 5014896..5015270 - 375 WP_101745082.1 outer membrane protein assembly factor BamE -
O2T12_RS20935 (O2T12_20935) 5015394..5015801 + 408 WP_219622117.1 ferric iron uptake transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-50)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5944.72 Da        Isoelectric Point: 3.7615

>T266884 WP_269675516.1 NZ_CP114886:5010661-5010816 [Endozoicomonas sp. GU-1]
MILWEEESLNDREKIFEFLYDFNPEAAEKTDLIIETKVENLLEQPLMGGAA

Download         Length: 156 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10971.21 Da        Isoelectric Point: 9.1596

>AT266884 WP_269675962.1 NZ_CP114886:5010377-5010661 [Endozoicomonas sp. GU-1]
METRIQFRVDEETKRLAQKMAESQGRTISDACREFTEQLAEQQRKLSSHDQWLTQQVNQAFEKLDSGATNFAEHDKAKDE
MAKRKAKIRNRGSQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References