Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2785601..2786132 | Replicon | chromosome |
Accession | NZ_CP114886 | ||
Organism | Endozoicomonas sp. GU-1 strain Ap1-3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | O2T12_RS11710 | Protein ID | WP_163373295.1 |
Coordinates | 2785601..2785888 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | O2T12_RS11715 | Protein ID | WP_163373296.1 |
Coordinates | 2785878..2786132 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O2T12_RS11675 (O2T12_11675) | 2781137..2781448 | - | 312 | WP_269673999.1 | HigA family addiction module antitoxin | - |
O2T12_RS11680 (O2T12_11680) | 2781724..2782185 | - | 462 | WP_269674000.1 | hypothetical protein | - |
O2T12_RS11685 (O2T12_11685) | 2782236..2782847 | - | 612 | WP_269674001.1 | hypothetical protein | - |
O2T12_RS11690 (O2T12_11690) | 2782884..2783855 | - | 972 | WP_269674002.1 | IS66 family transposase | - |
O2T12_RS11695 (O2T12_11695) | 2783866..2784507 | - | 642 | WP_269674003.1 | transposase | - |
O2T12_RS11700 (O2T12_11700) | 2784639..2785007 | - | 369 | WP_269674004.1 | DUF3768 domain-containing protein | - |
O2T12_RS11705 (O2T12_11705) | 2785133..2785609 | + | 477 | WP_269674005.1 | hypothetical protein | - |
O2T12_RS11710 (O2T12_11710) | 2785601..2785888 | - | 288 | WP_163373295.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O2T12_RS11715 (O2T12_11715) | 2785878..2786132 | - | 255 | WP_163373296.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
O2T12_RS11720 (O2T12_11720) | 2786207..2788068 | + | 1862 | Protein_2292 | phage terminase large subunit family protein | - |
O2T12_RS11725 (O2T12_11725) | 2788074..2788274 | + | 201 | WP_269674006.1 | hypothetical protein | - |
O2T12_RS11730 (O2T12_11730) | 2788277..2789746 | + | 1470 | WP_269674007.1 | phage portal protein | - |
O2T12_RS11735 (O2T12_11735) | 2789736..2790746 | + | 1011 | WP_269674008.1 | Clp protease ClpP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11271.15 Da Isoelectric Point: 10.6676
>T266881 WP_163373295.1 NZ_CP114886:c2785888-2785601 [Endozoicomonas sp. GU-1]
MTYELDFSALAWKEWQKLNSTVREQFKAKLRKRLENPKVSKDKLSGQKDCYKIKLRNSGYRLVYQVLDDVVVVFVISVGK
RERSEAYKAAQKRLR
MTYELDFSALAWKEWQKLNSTVREQFKAKLRKRLENPKVSKDKLSGQKDCYKIKLRNSGYRLVYQVLDDVVVVFVISVGK
RERSEAYKAAQKRLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|