Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 1565669..1566468 | Replicon | chromosome |
Accession | NZ_CP114886 | ||
Organism | Endozoicomonas sp. GU-1 strain Ap1-3 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | O2T12_RS06705 | Protein ID | WP_269673118.1 |
Coordinates | 1565956..1566468 (+) | Length | 171 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | O2T12_RS06700 | Protein ID | WP_269673117.1 |
Coordinates | 1565669..1565938 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O2T12_RS06680 (O2T12_06680) | 1561263..1562570 | + | 1308 | WP_269673112.1 | tyrosine--tRNA ligase | - |
O2T12_RS06685 (O2T12_06685) | 1562708..1563286 | - | 579 | WP_269673113.1 | AmmeMemoRadiSam system protein A | - |
O2T12_RS06690 (O2T12_06690) | 1563448..1564227 | - | 780 | WP_269673114.1 | AmmeMemoRadiSam system protein B | - |
O2T12_RS06695 (O2T12_06695) | 1564441..1565541 | + | 1101 | WP_269676946.1 | AmmeMemoRadiSam system radical SAM enzyme | - |
O2T12_RS06700 (O2T12_06700) | 1565669..1565938 | + | 270 | WP_269673117.1 | DUF1778 domain-containing protein | Antitoxin |
O2T12_RS06705 (O2T12_06705) | 1565956..1566468 | + | 513 | WP_269673118.1 | GNAT family N-acetyltransferase | Toxin |
O2T12_RS06710 (O2T12_06710) | 1566503..1566934 | + | 432 | WP_269676033.1 | YkgJ family cysteine cluster protein | - |
O2T12_RS06715 (O2T12_06715) | 1567021..1568040 | - | 1020 | WP_269673119.1 | alcohol dehydrogenase AdhP | - |
O2T12_RS06720 (O2T12_06720) | 1568355..1569899 | - | 1545 | WP_269673120.1 | maltoporin LamB | - |
O2T12_RS06725 (O2T12_06725) | 1570253..1570744 | - | 492 | WP_269673121.1 | DUF2244 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 171 a.a. Molecular weight: 19108.35 Da Isoelectric Point: 7.9677
>T266878 WP_269673118.1 NZ_CP114886:1565956-1566468 [Endozoicomonas sp. GU-1]
VELDKGIHDRASFDCGETELNLFIQTQASKHMQAGISRTMVLPASNPFPNQKIPICAFYSITPGSICRDTLPEALVKKLP
RYPVPVFLIAQLAVHREFQGEGLGKICLVNALKYLWEINAHMRAYAIIVDCLTDAAEQFYAKYGFEVLCEHNGKVRMFLP
MKTVARLFSS
VELDKGIHDRASFDCGETELNLFIQTQASKHMQAGISRTMVLPASNPFPNQKIPICAFYSITPGSICRDTLPEALVKKLP
RYPVPVFLIAQLAVHREFQGEGLGKICLVNALKYLWEINAHMRAYAIIVDCLTDAAEQFYAKYGFEVLCEHNGKVRMFLP
MKTVARLFSS
Download Length: 513 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|